SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099ZEI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099ZEI0
Domain Number 1 Region: 267-412
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5e-24
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 
Domain Number 2 Region: 501-629
Classification Level Classification E-value
Superfamily PX domain 8.37e-22
Family PX domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099ZEI0
Sequence length 872
Comment (tr|A0A099ZEI0|A0A099ZEI0_TINGU) Sorting nexin-14 {ECO:0000313|EMBL:KGL80167.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_10057 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
VVTFYCSLGPDSLLPNILFNIKYKPKQLELPELFPHGHSCAVCGKVKCKRHRPALLLENY
QPWLDLKVPSKVDASLSEVLELVLENFIYPWYRNITDDESSVDELRGTLRFFASVLVRRI
HKVDVPTVVTKKMLKAAMKHIEVIAKARQKVKNAEFLQQAALEEYGPELHVALRSRRDEL
HYLRKLTELLFPYILPPKSTECRSLALLIREILPGSVFLPSLDFLADPDTVNHLLLIFFD
DSPPEKATEPTSSLVPFLQKFAEPRNKKPSVLKLELKEIRNQQDLLFRFMNFLKQEGAVH
VLQFCLTVEEFNDRILRPELSDTEKMALHEEVQKIYKTYCLDESIDKIRFDPFIVEEIQR
IAEGPYVDVVKLQTMRCLFEAYEHVLFLLENVFTPMFCHSDEYFRHLLRGAESPTRNSKF
NRSSLSLDDFRTTQKRGESFGISRIGNKIKGVFKSSAMEGAMLPNYNLNEDDDFIEEGVM
VMEDDSLEEAVSTPNTPRNLTAWKISIPYVDFFEDPSLEKKDRKERIPVFCIDVERNDRR
AVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQE
YLQKLLQHPELSNSQLLADFLSPNGGETQFLDKMLPDVNLGKIIKSVPGKLIKEKGQHLE
PFIMNFISSCESPKPKPSRPELTIVTPTSENNKKLFNDLFKNNANRSENTERRQNQNYFM
EMMTVEGVYDYLMFVGRVVFRIPDWLHHLFMGGRILFKNTLELYTDYYLHYKLEQLFQEH
RLVSLITLLRDAVFCESTEARSQRDKQQRAKQAFEEMMSYVPDLIGKCIGEEAKYEGIRL
LFDGLQQPVLNKQLTYVLLDIGIQELFPELSK
Download sequence
Identical sequences A0A099ZEI0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]