SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099ZKD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099ZKD7
Domain Number 1 Region: 29-111
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000563
Family NIPSNAP 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099ZKD7
Sequence length 130
Comment (tr|A0A099ZKD7|A0A099ZKD7_TINGU) Protein NipSnap 1 {ECO:0000313|EMBL:KGL82874.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_15031 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
AEGSWLRSLFVHKVDPRKDAHSNLLAKRETSSLYKIQFHNVKPECLDAYNSLTEEALPKL
HEDADYPCALVGSWNTWYGEQDQADAAFRRERSRLLLARRNQLLLEFSFWNEPLPRRGPH
VYELRTYKLK
Download sequence
Identical sequences A0A099ZKD7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]