SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099ZLV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099ZLV9
Domain Number 1 Region: 71-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-45
Family Regulator of G-protein signaling, RGS 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099ZLV9
Sequence length 210
Comment (tr|A0A099ZLV9|A0A099ZLV9_TINGU) Regulator of G-protein signaling 17 {ECO:0000313|EMBL:KGL81790.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_05586 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
MRKRQQSQNEGTSAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEDRGDNAGRPTHTTK
MESIQVIEECQNPTADEILSWAQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNLLDPSPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSLVENITGSTSET
Download sequence
Identical sequences A0A099ZLV9
XP_010219489.1.20684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]