SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099ZW08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099ZW08
Domain Number 1 Region: 129-381
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 2.48e-70
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00012
Further Details:      
 
Domain Number 2 Region: 7-103
Classification Level Classification E-value
Superfamily SNARE-like 2.41e-28
Family Clathrin coat assembly domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099ZW08
Sequence length 382
Comment (tr|A0A099ZW08|A0A099ZW08_TINGU) AP-3 complex subunit mu-1 {ECO:0000313|EMBL:KGL85353.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_06604 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
EKAVDVENVPPVIPTPHHYLISIYRDKIFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGE
CSETAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDT
LPTGQLSNIPWRRAGVKYTNNEAYFDVIEEIDAIIDKSGKVIYELIFVSCILLPGCELAL
TLCPLFQNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYV
KHMISFKENSSSGRFDVTIGPKQNMGKTVEGVVMTVHMPKAVLNMNLTSTQGTYTFDPVT
KVLTWDVGKITPQKLPSLKGIVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYG
EKYKPFKGVKYITKAGKFQVRT
Download sequence
Identical sequences A0A099ZW08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]