SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099ZYH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099ZYH9
Domain Number 1 Region: 97-163
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000135
Family Ovomucoid domain III-like 0.00017
Further Details:      
 
Domain Number 2 Region: 190-238
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000119
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 3 Region: 261-315
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000995
Family Ovomucoid domain III-like 0.0076
Further Details:      
 
Domain Number 4 Region: 25-61
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000549
Family TB module/8-cys domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099ZYH9
Sequence length 343
Comment (tr|A0A099ZYH9|A0A099ZYH9_CHAVO) Follistatin {ECO:0000313|EMBL:KGL87339.1} KW=Complete proteome; Reference proteome OX=50402 OS=Charadrius vociferus (Killdeer) (Aegialitis vocifera). GN=N301_14527 OC=Charadrius.
Sequence
MLNQRIHPGMLLLLMFLCHFMEDHTVQAGNCWLRQARNGRCQVPYKTDLSKEECCKTGRL
TTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCKMNKKNKPRCVCAPD
CSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVLCPGSSTCVV
DQTNNAYCVTCNRICPEPTSPEQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIK
AKSCEDIQCSAGKKCLWDFKVGRGQCALCDEPCPESKSDEAVCASDNTTYPSECAMKEAA
CSMGVLLEVKHSGSCNSINEDPEDEEEDEDQDYSFPISSILEW
Download sequence
Identical sequences A0A099ZYH9
XP_009892494.1.48241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]