SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0AYA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0AYA3
Domain Number 1 Region: 50-175
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.76e-46
Family Regulator of G-protein signaling, RGS 0.000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0AYA3
Sequence length 176
Comment (tr|A0A0A0AYA3|A0A0A0AYA3_CHAVO) Regulator of G-protein signaling 4 {ECO:0000313|EMBL:KGL99499.1} KW=Complete proteome; Reference proteome OX=50402 OS=Charadrius vociferus (Killdeer) (Aegialitis vocifera). GN=N301_09616 OC=Charadrius.
Sequence
MCKGLAALPATCLKSAKDMKHRLGFLLQKSDSCDYSSSQGKKEKSSQRISQEEVRKWADS
LENLIHHDRGLAAFRAFLKSEYSEENIEFWVSCEDYKKTKSPAKLSPKARKIYDEFISVQ
ATKEVNLDSCTREKTSHNMLEPTLSCFDEAQRKIFTLMEKDSYRRFLKSPYYLDLV
Download sequence
Identical sequences A0A0A0AYA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]