SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0B4D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0B4D0
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000392
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0B4D0
Sequence length 84
Comment (tr|A0A0A0B4D0|A0A0A0B4D0_9CELL) Uncharacterized protein {ECO:0000313|EMBL:KGM01715.1} KW=Complete proteome; Reference proteome OX=1408250 OS=Cellulomonas cellasea DSM 20118. GN=Q760_17890 OC=Cellulomonas.
Sequence
MVAEWDYPDVGVVLLDTPSGGHDTVMLDYRRCGPTGEPAVVHVDEDRVPREVAPSFAAFV
AALELATEDEDDDDDGDGDGDGDG
Download sequence
Identical sequences A0A0A0B4D0
WP_052104226.1.27321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]