SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0C663 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0C663
Domain Number 1 Region: 49-193
Classification Level Classification E-value
Superfamily Sortase 0.00000000000153
Family Sortase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0C663
Sequence length 194
Comment (tr|A0A0A0C663|A0A0A0C663_9CELL) Uncharacterized protein {ECO:0000313|EMBL:KGM14744.1} KW=Complete proteome; Reference proteome OX=862422 OS=Actinotalea fermentans ATCC 43279 = JCM 9966 = DSM 3133. GN=N867_16490 OC=Actinotalea.
Sequence
AEADDAAPLTRVPATSTAPTPAPAPPADVPDVPVSAATLPPAEQVVPPTGLAIDALGIAL
PVEPVGVQPDGQMEIPPQAEVAGWYRFGAAPGDPDGTVVIAAHVDSVASAGLGPFAKLGD
LAVGDAVSVTRADGAVVTYAVTGRSSVAKPEVAWGDVFLRDGGPRLVLVTCGGVWHQDRR
SYSDNVIVTAEPIG
Download sequence
Identical sequences A0A0A0C663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]