SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0CN69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0CN69
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.46e-34
Family SMI1/KNR4-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0CN69
Sequence length 139
Comment (tr|A0A0A0CN69|A0A0A0CN69_PHOLU) Uncharacterized protein {ECO:0000313|EMBL:KGM27781.1} KW=Complete proteome OX=29488 OS=Photorhabdus luminescens (Xenorhabdus luminescens). GN=KS18_12940 OC=Morganellaceae; Photorhabdus.
Sequence
MNNDLDKIINELKLLSGGERNNIDLPDDELLAQYERDIGFTFPNDYKKVLKEIGNVFYGS
IGLLSVTKDKQNYGELSQSLEDARELGVPKDWLPICEDNGNYYCLLSDGQVRYWSHDGYS
DEMWLDITDWLQQVWINGN
Download sequence
Identical sequences A0A0A0CN69 A0A1C0U9X3
WP_036810732.1.4469 WP_036810732.1.84120 WP_036810732.1.93466 WP_036810732.1.94638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]