SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0HIR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0HIR5
Domain Number 1 Region: 19-70
Classification Level Classification E-value
Superfamily Rubredoxin-like 4.71e-18
Family Rubredoxin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0HIR5
Sequence length 258
Comment (tr|A0A0A0HIR5|A0A0A0HIR5_9RHOB) [NiFe] hydrogenase assembly chaperone, HybE family {ECO:0000313|EMBL:KGM87035.1} KW=Complete proteome OX=1288298 OS=Roseovarius mucosus DSM 17069. GN=rosmuc_03336 OC=Rhodobacteraceae; Roseovarius.
Sequence
MSGFEGSYLGANDKISPQAIMECKICWTPYDPAEGDDTRQIEAGTPFVALPEDWKCPNCD
APKEQFLVGEDPGHGALAEAAMIGAKTHALVTDFTEVWHGKMRDVPIVNKLLHVQAVGFQ
MHEARPLGVLISPWFMNLVQLPAEGEDWSALVPGAKEVIGFASGEYEFIHNVREMVGGYK
ACSLFSPMGEFRSQAQAVDVARAVMVALFQDEHRAETDRAADIRAAREAEIAALEVPPAL
PEAPTRRQVISAGLASEG
Download sequence
Identical sequences A0A0A0HIR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]