SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0HUY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0HUY7
Domain Number 1 Region: 199-313
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.84e-25
Family DEP domain 0.014
Further Details:      
 
Domain Number 2 Region: 336-479
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.15e-25
Family Regulator of G-protein signaling, RGS 0.00096
Further Details:      
 
Domain Number 3 Region: 22-148
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000778
Family PadR-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0HUY7
Sequence length 512
Comment (tr|A0A0A0HUY7|A0A0A0HUY7_PARBD) Developmental regulator flbA {ECO:0000313|EMBL:KGM92427.1} KW=Complete proteome; Reference proteome OX=502780 OS=Paracoccidioides brasiliensis (strain Pb18). GN=PADG_11243 OC=Paracoccidioides.
Sequence
MSSGKMHQTSSRLLRMTSDDRPFTRDFKDLFSTLIVSLKLETHRVRFSKFEHTFTAEEAI
NNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEMARAVCQRSVDARFIESVDGRVT
TQFPLKGALFQLTPKGIHILQRFCQRNGITARHILDVLESPRNTMQLVILERDSTTDQIS
QDRATIEVIFRRFAGQDGPNIKSSVSTSDSDSVSDYSNGLVGVKLARERKVGDKIIHNSF
TGKAAVDWLMDCCTIIDRLETFEIATMFVKQGLISAVFEDKNFIQQNPDATLFQPTKYAI
YAVTERGSRICGWIAREKPVVSTFDGRIAPRDSNNARLNNILQDPALRLLFREFLRYSLC
EENLSFYLDVSEFTADYHRKEKAGSFAKMDAVRETLASAYGLYNAFLAPGSPCELNIEHA
LRNSLASRMTRAVGDDASMLKSLTEVVGLFELAQVSVFKLMSSDSVPKFVRDPKYAVVLQ
DHDVELNNPSGRSFSPTAAPIPERSLSRSTKS
Download sequence
Identical sequences A0A0A0HUY7
XP_010757807.1.95046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]