SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0I538 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0I538
Domain Number 1 Region: 19-139
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 6.28e-30
Family Family 1 bi-partite nucleotidyltransferase subunit 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0I538
Sequence length 145
Comment (tr|A0A0A0I538|A0A0A0I538_CLONO) Nucleotidyltransferase {ECO:0000313|EMBL:KGM95436.1} KW=Complete proteome OX=1444289 OS=Clostridium novyi A str. 4552. GN=Z968_09110 OC=Clostridium.
Sequence
MSGILDKYNESIRLTYNYTYRMLTHLKNIKDNYKKLKDADDITLEVYRDSIIKKYETLED
LTWKLLSKIFKADGLEINNPRGCYKQAFKEGLIQDMIIWNEILLARNSTAHIYDESDYEA
IKNNILEKYIGAIENLLNKISMEKL
Download sequence
Identical sequences A0A0A0I538
WP_039255738.1.87003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]