SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0J8F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0J8F8
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 4.97e-20
Family MOSC N-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 4-52,157-279
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 9e-16
Family MOSC (MOCO sulphurase C-terminal) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0J8F8
Sequence length 282
Comment (tr|A0A0A0J8F8|A0A0A0J8F8_9MICO) Molybdenum cofactor biosysynthesis protein {ECO:0000313|EMBL:KGN33705.1} KW=Complete proteome; Reference proteome OX=1385520 OS=Knoellia sinensis KCTC 19936. GN=N802_07770 OC=Bacteria; Actinobacteria; Micrococcales; Intrasporangiaceae; Knoellia.
Sequence
MSSPRVVGLNVHPVKSTAIRAVESVFVEPAGFAGDRRFMVVDTDGQLVSAREVHRLFAIT
ADVPATDPTLAGGLRLRADGVDDLLVGDAEGDEVPVRLHRHDLTGLLVSRKADDWISAVV
GRPGLRLVRCVDPTRRALNPAFSREGDHTAYADGYPVTLASLRSLAQLNDWIAEGAVERG
ETQPDPMPIERFRPNVVIDGDLDAFVEDSWGRVRLGDVDFRVAKPVDRCVMTTIDPVTLA
TSKEPIRTLSRHRRWDGTTWFAIQLIPDNTGAVRLGDRVLAD
Download sequence
Identical sequences A0A0A0J8F8
WP_035913210.1.97350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]