SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0KHN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0KHN9
Domain Number - Region: 73-255
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.00432
Family Neurotransmitter-gated ion-channel transmembrane pore 0.012
Further Details:      
 
Domain Number - Region: 4-94
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0706
Family Glycerol-3-phosphate transporter 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0KHN9
Sequence length 285
Comment (tr|A0A0A0KHN9|A0A0A0KHN9_CUCSA) Uncharacterized protein {ECO:0000313|EMBL:KGN47296.1} KW=Complete proteome; Reference proteome OX=3659 OS=Cucumis sativus (Cucumber). GN=Csa_6G290280 OC=Benincaseae; Cucumis.
Sequence
MRTSNHLIGLLNFLTFVLSIPILAGGIWLSSKANSTECLRFLQWPLIIIGVAIMVVSLAG
FAGACYRNTFLMWLYLFVMFFVIVALIVFIVFAYAVTDKGSGRTVPSRVYLDYYLQDYSG
WLKDRVAEESYWEKISSCVRDSKVCKKMGRIVGGVPESVEMFNLRKLSPIESGCCKPPSD
CGFSYQNETVWTGVEGMVLFNSDCTNWNNDQSELCYNCDSCKAGVLASLKRSWRKVSVIN
IVVLIILVIAYVIGIAAFRNNRRIDNEEASGEARMEKARPSWIHS
Download sequence
Identical sequences A0A0A0KHN9
Cucsa.052700.1|PACid:16954268 XP_004149556.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]