SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0KI21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0KI21
Domain Number 1 Region: 48-262
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 2.22e-79
Family Chlorophyll a-b binding protein 0.00000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0KI21
Sequence length 265
Comment (tr|A0A0A0KI21|A0A0A0KI21_CUCSA) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} KW=Complete proteome; Reference proteome OX=3659 OS=Cucumis sativus (Cucumber). GN=Csa_6G522690 OC=Benincaseae; Cucumis.
Sequence
MAASAMALSSPTLAGQAVKLSPTAPEIQGNAKFTMRKTASKSVSSGSPWYGPDRVKYLGP
FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSR
NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGP
LGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLE
NLADHLADPVNNNAWAYATNFVPGK
Download sequence
Identical sequences A0A0A0KI21
XP_004134608.2.97903 Cucsa.047550.1|PACid:16953696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]