SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0L8A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0L8A4
Domain Number 1 Region: 303-441
Classification Level Classification E-value
Superfamily ApaG-like 3.53e-28
Family ApaG-like 0.00048
Further Details:      
 
Domain Number 2 Region: 11-75
Classification Level Classification E-value
Superfamily F-box domain 0.000000000067
Family F-box domain 0.0065
Further Details:      
 
Domain Number 3 Region: 92-206
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000144
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0L8A4
Sequence length 441
Comment (tr|A0A0A0L8A4|A0A0A0L8A4_CUCSA) Uncharacterized protein {ECO:0000313|EMBL:KGN57249.1} KW=Complete proteome; Reference proteome OX=3659 OS=Cucumis sativus (Cucumber). GN=Csa_3G174030 OC=Benincaseae; Cucumis.
Sequence
MELEGVDDLFLHLVFAKLGPKDSAIAACVSRQFRSSASEDSLWKKFCNQDLNLTDPVDHL
GNPIPSFKETYQVWRRAFGMYPWPLVKRVKRCWDRLKNWLSTNFPEALRTLRDGASEADI
EELENVLKVKLPLPTRILYRFHNGQELKGGYVDSIRGFPLGLIGGYTFYGETVNVYLLPL
RQVVFETKSIIRDVGFSRKSKFIVVASSSTFTEKVFFLNCASGQLFVGTAKLRDDGEMIP
CVPGALINSVHECNTEQQQDAMLLWLEEHVRRLENGIIKLREIKNIRSISLFPEEPPLCS
TAVTNGVRVRASAIFLPESTDILDSSGNHQFAYSIRMSLQDEGCIINGMIFNSCQLHLRH
WKVRANDHVISIVDGEAVIGKFPLLKPGEEFVYESCSSLYSSVGSLEGSFTFVPGSLAYP
EGSPFEVQVARFPLQVPTYIF
Download sequence
Identical sequences A0A0A0L8A4
XP_011651112.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]