SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0M7Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0M7Q8
Domain Number 1 Region: 20-147
Classification Level Classification E-value
Superfamily PapD-like 4.3e-46
Family Pilus chaperone 0.00015
Further Details:      
 
Domain Number 2 Region: 141-235
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.1e-16
Family Periplasmic chaperone C-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0M7Q8
Sequence length 239
Comment (tr|A0A0A0M7Q8|A0A0A0M7Q8_9GAMM) Pilus assembly protein PapD {ECO:0000313|EMBL:KGO99120.1} KW=Complete proteome; Reference proteome OX=1385515 OS=Lysobacter defluvii IMMIB APB-9 = DSM 18482. GN=N791_11655 OC=Xanthomonadaceae; Lysobacter.
Sequence
MKPFLARALLAATLLLTCSLPAMAGVIINGTRVVYPAQSREVTVQLTNTGDSPALVQAWI
DSGDPDQAPEDSAAPFVITPPISRIEPGRGQALRIIFAGEPLPPDRESVYWLNVLEVPPA
PDAGAEQNYLQVAFRSRVKLFYRPQGLPGTANEAPEALQWTGGAAVLQVTNPTPFHVTVV
GLQARSADGTGLQTLEDKGRMLAPGESARWPVDGPVGQVAFTTVNDYGGRVEYTSAVEP
Download sequence
Identical sequences A0A0A0M7Q8
WP_027070685.1.100449 WP_027070685.1.73016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]