SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MR47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MR47
Domain Number 1 Region: 112-201
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.33e-35
Family SCAN domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 474-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 239-294
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 420-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000298
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  A0A0A0MR47
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000275
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MR47
Sequence length 611
Comment (tr|A0A0A0MR47|A0A0A0MR47_HUMAN) Neurotrophin receptor-interacting factor homolog {ECO:0000313|Ensembl:ENSP00000321209} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF274 OC=Catarrhini; Hominidae; Homo.
Sequence
MLENYRNLVSVEHQLSKPDVVSQLEEAEDFWPVERGIPQDTIPEYPELQLDPKLDPLPAE
SPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDGSLSADAPSEQVQQQGKHPGDPEAARQ
RFRQFRYKDMTGPREALDQLRELCHQWLQPKARSKEQILELLVLEQFLGALPVKLRTWVE
SQHPENCQEVVALVEGVTWMSEEEVLPAGQPAEGTTCCLEVTAQQEEKQEDAAICPVTVL
PEEPVTFQDVAVDFSREEWGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSD
IPEEEPAPSLKVQESSRDCALSSTLEDTLQGGVQEVQDTVLKQMESAQEKDLPQKKHFDN
RESQANSGALDTNQVSLQKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKH
NSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYF
SVHKKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQECGRTFNDRSAISQHL
RTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHN
RTKRKKKQPTS
Download sequence
Identical sequences A0A0A0MR47
NP_001265663.1.87134 NP_001265663.1.92137 ENSP00000321209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]