SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MRD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0MRD0
Domain Number - Region: 471-512
Classification Level Classification E-value
Superfamily F1 ATPase inhibitor, IF1, C-terminal domain 0.0706
Family F1 ATPase inhibitor, IF1, C-terminal domain 0.0093
Further Details:      
 
Domain Number - Region: 176-220
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0883
Family Regulator of G-protein signaling, RGS 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MRD0
Sequence length 646
Comment (tr|A0A0A0MRD0|A0A0A0MRD0_HUMAN) Protein FAM227A {ECO:0000313|Ensembl:ENSP00000348086} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM227A OC=Catarrhini; Hominidae; Homo.
Sequence
MEVINLTTLPMIPVDEHLAVSLVARNTMVKTVRKELENNPPSCLIGSMHQVNQKIADINL
RTEPSANSLAIERFELEKKALREKTRSSPEDKVKRQRKSQYSCKGSELRHARSSVIKRKT
ADKNLLAELYQYSNFNSSKPNKLPNGVDFCDMVGNVVRAERDCLSGKHFCSGRELEKFLS
SSSPRAIWLDSFWWIFHERYQPNKELQNNLFDRIAQHYALLLFRVPKSHSEEALLKRLPS
LLSKAVYTSFCCCFPQSWFDTHEFKSDICNTMSLWISGGTYPSPQSYDSWDYSELDPERF
RREELMLYRRRLTKGREFSLFAGKRAFSQKPAQSRKFYHPQSSSANSPSEKTSSAKQNSE
KSLRMQNTAKEHHCQTLVLKKPTQEVKRISEARECENMFPKKSCAACKSPELTSNLFNIY
GKSPLIVYFLQNYASLQQHGKNVLIVRREKTTSTPDCTPTYTDVISETLCSMKKRKDNLN
QLYQHHWTEWNYFDKHLKELQDNFSREMKNIDPKAADTKKANHMFIPPSAVNEESPDKKT
KGSLQREIEFKGCSNKNHGKGRSVNMRGKEEREREEKQKLNISFHSLPSPEELHNLEPGS
AYRIRDISATRTPLRRPSSWEPSLIYQEQVLLKTHTLSMEEDKFRC
Download sequence
Identical sequences A0A0A0MRD0
ENSP00000348086 ENSP00000348086 ENSP00000348086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]