SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MXL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MXL6
Domain Number 1 Region: 149-276
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-46
Family Regulator of G-protein signaling, RGS 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MXL6
Sequence length 302
Comment (tr|A0A0A0MXL6|A0A0A0MXL6_PONAB) Regulator of G-protein-signaling 4 {ECO:0000313|Ensembl:ENSPPYP00000000674} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0042051 OC=Catarrhini; Hominidae; Pongo.
Sequence
MYNMMLLIQKRKGIGSQLLRAGEAEGARGAGTAELLSDWLDSRSWAIKETPTGLGGRRSE
DSDNIFTGEEAKYAQSRSHSSSCRISFLLANSKLLNKMCKGLAGLPASCLRSAKDMKHRL
GFLLQKSDSCEHNSSHNKKDKVIICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSE
YSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQASKEVNLDSCTREETSRNMLE
PTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQ
CA
Download sequence
Identical sequences A0A0A0MXL6
ENSPPYP00000000674 XP_009239787.1.23681 ENSPPYP00000000674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]