SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0NMZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0NMZ8
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0863
Family Poly(A) polymerase, PAP, middle domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0NMZ8
Sequence length 130
Comment (tr|A0A0A0NMZ8|A0A0A0NMZ8_9ACTN) Membrane protein {ECO:0000313|EMBL:AGP58581.1} KW=Complete proteome OX=1343740 OS=Streptomyces rapamycinicus NRRL 5491. GN=M271_35880 OC=Streptomyces.
Sequence
MPLSEHEQRMLEQMERALYAEDPKFATALEGSGLRTYTRRRVYQAVAGFLAGIALLMVGV
IVPQIWISVVGFLIMLGCAVLAVTGWRKAPKPGEAQRGGGAAPRRQGRQRRSMMTRIEER
WQRRRDEQGH
Download sequence
Identical sequences A0A0A0NMZ8
gi|557689977|ref|YP_008793537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]