SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0NXH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0NXH6
Domain Number 1 Region: 8-97
Classification Level Classification E-value
Superfamily TRAF domain-like 6.28e-31
Family SIAH, seven in absentia homolog 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0NXH6
Sequence length 97
Comment (tr|A0A0A0NXH6|A0A0A0NXH6_9NEOB) E3 ubiquitin-protein ligase {ECO:0000256|RuleBase:RU201113} OX=1165454 OS=Rana sp. CEN-2012. GN=SIA OC=Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana.
Sequence
AMEKVANSVLFPCKYASSGCEVTLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVM
PHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQ
Download sequence
Identical sequences A0A0A0NXH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]