SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0PU32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0PU32
Domain Number - Region: 35-58
Classification Level Classification E-value
Superfamily Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0177
Family Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0091
Further Details:      
 
Domain Number - Region: 12-45
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0265
Family Blood coagulation inhibitor (disintegrin) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0PU32
Sequence length 68
Comment (tr|A0A0A0PU32|A0A0A0PU32_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AHK10960.1} KW=Complete proteome OX=1434323 OS=Escherichia phage HY01. GN=HY01_0103 OC=Tevenvirinae; T4virus.
Sequence
MSQTSILKNAHCEKCKWPVVFALCNDEMACDFDYWCYCSNKGCINHKGEGFYSGFYPYPD
FVKEGKPK
Download sequence
Identical sequences A0A097J8U3 A0A0A0PU32 A0A0F6TJ59 A0A0M7QAR7 A0A160CB84 A0A193H1M1 A0A1L7DR93 A0A249XVM2 A0A249XZ19 C3V1H6 C3V2A1 F2VXD1 G0X5N7 I7AU08 I7J458 K4FCJ0
gi|228861047|ref|YP_002854070.1| gi|228861429|ref|YP_002854450.1| gi|330858633|ref|YP_004415008.1| gi|414086476|ref|YP_006986665.1| gi|422934896|ref|YP_007004856.1| YP_002854070.1.35387 YP_002854450.1.52523 YP_004415008.1.39753 YP_006986665.1.40608 YP_007004856.1.71933 YP_009102584.1.19893 YP_009148554.1.10008 YP_009149356.1.33003 YP_009197343.1.55766 YP_009288479.1.44423 YP_009290377.1.45152 C3V1H6_9CAUD C3V2A1_BPR51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]