SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0TQ75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0TQ75
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.35e-22
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0TQ75
Sequence length 146
Comment (tr|A0A0A0TQ75|A0A0A0TQ75_BACIU) Uncharacterized protein {ECO:0000313|EMBL:AIW33222.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=KS08_06055 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTEWRFAEEPIGETTVKKIEKALDIKFPNDYISTILNNNGARPSKKIFDYENTKGAVFNR
LHGLTEDSSSFILEILEDYQDGRMLSGIVPFASDPFGNEICFDYRQNKENPSVVFWDHEI
AYEDPDGALSHICDSFTELVDKLYEE
Download sequence
Identical sequences A0A0A0TQ75
WP_014470534.1.54561 WP_014470534.1.65712 WP_014470534.1.70510 gi|384159839|ref|YP_005541912.1| gi|384168905|ref|YP_005550283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]