SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0TRR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0TRR3
Domain Number 1 Region: 36-165
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-24
Family SMI1/KNR4-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0TRR3
Sequence length 177
Comment (tr|A0A0A0TRR3|A0A0A0TRR3_BACIU) SPBc2 prophage-derived protein YokH {ECO:0000313|EMBL:AIW34166.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=KS08_11150 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEEGKLIQMTLNGIKEAVSKYGTFPMFHHGGYVMEDATFHFKDPASPQEISDIEQKLGVT
FPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKS
KNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSSNGTKYWEVNPNIREYYKLVSE
Download sequence
Identical sequences A0A0A0TRR3 A0A0X8KJU1 S6FHB0
WP_014470067.1.1127 WP_014470067.1.11310 WP_014470067.1.24336 WP_014470067.1.45935 WP_014470067.1.52720 WP_014470067.1.54561 WP_014470067.1.61562 WP_014470067.1.65712 WP_014470067.1.70510 WP_014470067.1.80835 WP_014470067.1.94746 WP_014470067.1.97917 gi|384167852|ref|YP_005549230.1| gi|384158789|ref|YP_005540862.1| gi|530569929|ref|YP_008413144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]