SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0TS44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0TS44
Domain Number - Region: 44-71
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0589
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0TS44
Sequence length 200
Comment (tr|A0A0A0TS44|A0A0A0TS44_BACIU) Uncharacterized protein {ECO:0000313|EMBL:AIW32643.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=KS08_02915 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MHIMRGAHIIVIQLKIIYKAVLVILISACFLLFNGWYFHKCIIDPHYYQLTDFSEEDIQI
FEHFYNIDLPSNTKFIKAEQFETGIGNYSAILYVSLPAKKVKPLVSDYSYMPIFYNNRYT
VFYGVNITSNNKETAQITFGADDSSLNGSLWSKQVRNLLESKGKYIGVSDETYVISAFII
NIVFIALIVWILKKSRRTRV
Download sequence
Identical sequences A0A0A0TS44 A0A1Y0X4X4
gi|384158169|ref|YP_005540242.1| WP_014469835.1.1127 WP_014469835.1.1325 WP_014469835.1.33972 WP_014469835.1.54561 WP_014469835.1.65712 WP_014469835.1.70207 WP_014469835.1.70510 WP_014469835.1.80835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]