SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0TU79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0TU79
Domain Number 1 Region: 138-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.45e-52
Family AadK C-terminal domain-like 0.00000192
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.04e-50
Family AadK N-terminal domain-like 0.00000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0TU79
Sequence length 289
Comment (tr|A0A0A0TU79|A0A0A0TU79_BACIU) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:AIW32715.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=KS08_03300 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRSENEMMKLILDIAMKDERIRLVTLEGSRTNKNVPRDRFQDYDISYFVTDMDSFTSDES
WLDQFGERMMMQKPEDMELFPPELGDWFSYLMLFKDHHKIDLTLIPVNQTEHYFTQSDGL
AEILLDKDDRIKRKIIASDEQYHIKKPTPREFDDCCNEFWMVSTYVIKGLMRKEILFALD
HMNDILRPNVLRMIAWKIGIENQFSLSVGKNYKYIQKYMNAEDWEILLNTFVGNTYESVW
KALFDCQGLFRAYSKSVAVLLRYEYPEYDQQITEYTLTHYQRFQSEFSL
Download sequence
Identical sequences A0A0A0TU79
gi|384158243|ref|YP_005540316.1| gi|384167287|ref|YP_005548665.1| gi|308172570|ref|YP_003919275.1| gi|384163124|ref|YP_005544503.1| WP_013351311.1.1127 WP_013351311.1.1325 WP_013351311.1.33972 WP_013351311.1.54561 WP_013351311.1.65712 WP_013351311.1.70207 WP_013351311.1.70510 WP_013351311.1.80835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]