SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0TVJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0TVJ1
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000863
Family SMI1/KNR4-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0TVJ1
Sequence length 146
Comment (tr|A0A0A0TVJ1|A0A0A0TVJ1_BACIU) Uncharacterized protein {ECO:0000313|EMBL:AIW35451.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=KS08_18030 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKYDFINSYKENTFYPVSENEILEVENKLGLRLPYDLRQFLLEVGYGFLKKSEYNINRIL
GPASIRDARLKVNDFEFYPDIEVYEELEEDKVIFFEANESALLLIELGNEQNNSIYYDDI
KIADSLEEFLIELMKNDKYYLDLIED
Download sequence
Identical sequences A0A0A0TVJ1 A0A1Y0XPS0
gi|308175351|ref|YP_003922056.1| gi|384166135|ref|YP_005547514.1| gi|384170330|ref|YP_005551708.1| gi|384161235|ref|YP_005543308.1| WP_013353854.1.1127 WP_013353854.1.1325 WP_013353854.1.33972 WP_013353854.1.54561 WP_013353854.1.65712 WP_013353854.1.70207 WP_013353854.1.70510 WP_013353854.1.80835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]