SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0U027 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0U027
Domain Number - Region: 31-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000942
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0U027
Sequence length 183
Comment (tr|A0A0A0U027|A0A0A0U027_BACIU) Uncharacterized protein {ECO:0000313|EMBL:AIW35453.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=KS08_18040 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLLPEEFNRSWDVNKNGPLLTFPYDDLVETPFSEGFKKFISLGGLPESPPPYLDFTSFPA
SFKPITSIFDVSEGFQKYWLLGSTGSGDPICIIENNERIVYLDNGNEYKEVFINSSINQF
AECILLFSEMIDKAIHINGEDAFIDNDIPEYVIEWLKEELKRVDSNCTREGSFWGTEIEN
LYE
Download sequence
Identical sequences A0A0A0U027 A0A1Y0XKL1
gi|384170333|ref|YP_005551711.1| gi|384166138|ref|YP_005547517.1| WP_013353856.1.1127 WP_013353856.1.1325 WP_013353856.1.33972 WP_013353856.1.54561 WP_013353856.1.65712 WP_013353856.1.70207 WP_013353856.1.70510 WP_013353856.1.80835 gi|308175353|ref|YP_003922058.1| gi|384161237|ref|YP_005543310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]