SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0WI19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0WI19
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000353
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0WI19
Sequence length 152
Comment (tr|A0A0A0WI19|A0A0A0WI19_BACMY) Uncharacterized protein {ECO:0000313|EMBL:AIW83439.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=bwei_0773 OC=Bacillus cereus group.
Sequence
MFDFLKNFVVADESIKSDQTPIFYPLKSEEIEEAEDLLKMKFPKELKNFYKEIGYGFLEA
SSKFFFNRFMDPFSVVDFRLRQDIYEYNPNIDGVDDEESLVFFEVTELSFLTIKFKQANE
LGQCPIYSEDEKIADSLEEFLIKMGENPDYYI
Download sequence
Identical sequences A0A0A0WI19 C2SPX5
WP_002033953.1.30061 WP_002033953.1.4496 WP_002033953.1.57105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]