SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0WMH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0WMH7
Domain Number 1 Region: 17-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.28e-20
Family SMI1/KNR4-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0WMH7
Sequence length 150
Comment (tr|A0A0A0WMH7|A0A0A0WMH7_BACMY) Uncharacterized protein {ECO:0000313|EMBL:AIW83437.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=bwei_0771 OC=Bacillus cereus group.
Sequence
MWKNLILEIEKVERSFNDKLNTPATDTEIGKLRERVKENFNVDLPSEYEEFLKTVNGLDF
SGLVLYGVDSYLLDTERDESICGLIETNEIWYENEFQKEYLFLGDSNIAWFCKNLSDGIY
LELDKPSGTVMNTYNDCNTMLEEALKAALL
Download sequence
Identical sequences A0A0A0WMH7 A9VGC1 C2SPX7
WP_002033951.1.30061 WP_002033951.1.4496 WP_002033951.1.57105 WP_002033951.1.99908 315730.BcerKBAB4_4018 gi|163941925|ref|YP_001646809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]