SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0WNC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0WNC1
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.75e-58
Family AadK C-terminal domain-like 0.0000461
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.14e-49
Family AadK N-terminal domain-like 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0WNC1
Sequence length 292
Comment (tr|A0A0A0WNC1|A0A0A0WNC1_BACMY) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:AIW85673.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=bwei_3054 OC=Bacillus cereus group.
Sequence
MRTEKEMLDLIINTAKEDERIRAVIMNGSRVNPNVKKDCFQDYDIIYVVKDIQSFTCNHS
WINRFGEIMIVQMPEEMSLLPADKDGEFPYLMQFMDGNRIDLMLVPVDLINKFIGQDSLS
KLLLDKDKCIGEFPPASDKDYVIKNPTEKEFFDCCNEFWWCSTNVGKGLWREELSYAKGM
LEGPMRDMLIVMLEWHIGMKTNFTVNTGKFGKHFEQYVEKDTWEQFRNTFSNAEYENIWE
SFFVMGDLFREVANEIANTYGYQYPQDDDDKVTSYLKHVKVLPKGSTSIYPA
Download sequence
Identical sequences A0A0A0WNC1 C2SIW1
WP_002031365.1.30061 WP_002031365.1.4496 WP_002031365.1.57105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]