SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1DXH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A1DXH2
Domain Number - Region: 136-191
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000405
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1DXH2
Sequence length 531
Comment (tr|A0A0A1DXH2|A0A0A1DXH2_ASF) PMGF 505-1R {ECO:0000313|EMBL:AIY22212.1} KW=Complete proteome OX=10497 OS=African swine fever virus (ASFV). GN=BA71-A531R OC=Viruses; dsDNA viruses, no RNA stage; Asfarviridae; Asfivirus. OH=6938,9823,41426
Sequence
MFSLQNLCRKTLPDCKLPEFFDDYILQLLGLYWENHGTIQRAGNNCVLIQQHTLIPVNEA
LRIAASEENYEIVGLLLAWEGNLYYAIIGALEGNRYNLIRKYDDQIKDHHDILPFIDDPI
IFHKCHIMRRCFFDCILYQAVKYSKFRVLLYFKYTLEDDLPLVHLLIEKACEDHNYEVIK
WIYENLHVCHIIDTFDCAIAHKDLRLYCLGYTFIYNRIVPYKYHHLDILILSSLQLLHKV
AAKGYLDFILETLKYDHNIDNLDVILTQAATYNHRKILTYFIPQSTYAQIEQCLFVAIKT
KSSKKTLNLLLSHLNLSIKLIQKISQYVATFNSTNIIGILSMKRKKKIYLDIILTKFVKN
AIFNKFVVRCMERFSINPERIVKMAARINKMMLVKKISEHVWKNHAARLKHLKHAVHTMK
HKDGKNRLMNFIYEHCYYHMQGEEIFSLARFYAIHHAPKLFDVFYNCCILDTIRFKSLLL
DCSHIIGKNAHDATNINIVNKYIGNLFAMGVLSKKEILQDYPSIYSKHYMP
Download sequence
Identical sequences A0A0A1DXH2 A9JKU5 D4I5K9
A9JKU5_ASFPB D4I5K9_ASF

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]