SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1E0Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A1E0Y2
Domain Number - Region: 142-237
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00314
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1E0Y2
Sequence length 328
Comment (tr|A0A0A1E0Y2|A0A0A1E0Y2_ASF) PMGF 300-4L {ECO:0000313|EMBL:AIY22373.1} KW=Complete proteome OX=10497 OS=African swine fever virus (ASFV). GN=J328L OC=Viruses; dsDNA viruses, no RNA stage; Asfarviridae; Asfivirus. OH=6938,9823,41426
Sequence
MLSLFNIALKTLKNHIEFLKHDKDILTHLGLCCKNYDLIHKCSECGNICPNRQQHGTCIN
INYLLIYAVKCDNYMLAYRLLCWGANEKFAHYFRRPLPNLKPLLPKKELTPKDIKQLAYE
HFYSDSELITVFEVFRRCRNINDCLEFFYKKNLEFEIYFARLHVYSKTFYRKSWYWFCIF
MAVKHGMKQALKKITKTYIPTFYNKTTLNLVLFLSACFYENVEWMKYFFYKANKKIQQRM
LSYGMEWAATHGKVRTFVCCYTLGGTASLKMYQKAYQNERYMIMALCSYLGNIQINNPWD
NLNPYMMMQNKEKFLPLKFSEETQYFYI
Download sequence
Identical sequences A0A097SRX3 A0A0A1E0Y2 A9JKT7 A9JLK6 D4I5K3
YP_009094907.1.62832 A9JKT7_ASFPB A9JLK6_ASFPP D4I5K3_ASF

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]