SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1I386 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1I386
Domain Number 1 Region: 107-229
Classification Level Classification E-value
Superfamily OmpA-like 8.37e-35
Family OmpA-like 0.00051
Further Details:      
 
Domain Number 2 Region: 70-101
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000314
Family TSP type-3 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1I386
Sequence length 231
Comment (tr|A0A0A1I386|A0A0A1I386_9PSED) Outer membrane protein A {ECO:0000313|EMBL:CDF97006.1} KW=Complete proteome OX=984195 OS=Pseudomonas sp. SHC52. GN=BN844_3330 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSIVRTALPLVLLTGVLTGCAGLQKTDWPTCAAVGGVVGAGLGATESTSWAGYGALFAGS
MAAAYCWVHGDGDEDGDGVPDSRDKCPGTPKGVQVDADGCPPPAPAPMAEEPVVVKEETI
VVRDVHFEFNKSTLTAADKEVLSGVATRLKQESSTAQLRVTGHTDSVGSNAYNQRLSEKR
ANSVVQYLVESGVPRASFVSVAGAGESQPVADNKTAEGRAMNRRTEIKINR
Download sequence
Identical sequences A0A0A1I386
WP_041024510.1.18324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]