SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1MX11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1MX11
Domain Number 1 Region: 11-200
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.52e-42
Family Poly(A) polymerase, PAP, N-terminal domain 0.00000771
Further Details:      
 
Domain Number 2 Region: 205-300
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.71e-36
Family Poly(A) polymerase, PAP, middle domain 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1MX11
Sequence length 303
Comment (tr|A0A0A1MX11|A0A0A1MX11_9FUNG) Putative Catalytic activity: N ATP (Nucleotide)(M) <=> N diphosphate (Nucleotide)(M N) (Precursor) {ECO:0000313|EMBL:CEI88995.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMCBS344292_03370 OC=Rhizopodaceae; Rhizopus.
Sequence
MSESQENRVYPGITKPLSLEKPGPRDIQLTIELEKTLNLYGLYDSEERAQQRCRVLQSLD
DLTKQFVKMVYEKKGYTELAKKAGGKVFTYGSYRLGVNATDADIDTLCVFPKYVDRIDFF
TVMLELLKTHEHITDITAVTNAYVPLIKFKFNDIPIDFICARLNVDQIPEDIDLKDSNLL
RNLDALSVRSLNGTRVADDILDLVPNVDTFRTVLRCIKLWATRKAIYSNVLGFLGGVAWA
ILVARICQLYPNASASTVIDKFFHILITWPWPSPVLLKAVEDGPIVPTIKPWNPKVCDKD
KQK
Download sequence
Identical sequences A0A0A1MX11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]