SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1N7P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1N7P1
Domain Number 1 Region: 152-464
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.05e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.031
Further Details:      
 
Domain Number 2 Region: 29-133
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000103
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1N7P1
Sequence length 662
Comment (tr|A0A0A1N7P1|A0A0A1N7P1_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEI88539.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMCBS344292_02923 OC=Rhizopodaceae; Rhizopus.
Sequence
MLKHLINESEETLTMNTYFVKENDENKRLDYILSCPQQLACFQAYLQEIHAHENLLFIEA
LSELRHEKDMNNIEVIVLRIWKTFFSSDSQLELNVYNKNRVNAYFQAHKWAIVTKEEALS
VFRNAELEAKQFLNEKVIEFDKIYGPHMPVNQLYSRYKKRVVVIGGGFTGFTIASILDPM
PRFHVTLVDTKDSFEYTPGMIKLLVRPEQTSSLRVRHDAYVKNGRVVIGYAEKIINDGKA
VQVNNEIIPFDYLAICTGSRYKSKLKSFDISSLYRLSELANEHNDLKRAKSVLIIGGGLV
GCELASEIATHQYLPPYDFKKKITIVDSYPCLVRRSSAKRQQNALNYFQSLGVEVVLNEK
IVDFDSANTNSYLGSRGTIYKGYDKVFLATGTSPCSELLQDGGDIGFESCVDHWGRARVK
PTLQLDHWKYDHIFAGGDITNVVEEKTGYAATLAGVCIARNICRMEKGKSPLNQGSKGTL
PAPKKPLHGIESNGGIGRQQLCTFKKTFSFLNPTWAALKYFDEKEFLEIVQGEARVVKTA
VGKKPKILGLPGKLELFKSKEQQKQQKQQKQQPAPLTSFGSPISRILFHKTSTTNLSGSD
VISNSNFSMNDTESEFNCTCVSDSESDHPYDDDDYKSKTIQRFLKHDSLQPRPHSLSPGH
AI
Download sequence
Identical sequences A0A0A1N7P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]