SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1NDE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1NDE8
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily ENTH/VHS domain 5.05e-18
Family VHS domain 0.0054
Further Details:      
 
Domain Number 2 Region: 151-234
Classification Level Classification E-value
Superfamily GAT-like domain 0.0000000000471
Family GAT domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1NDE8
Sequence length 286
Comment (tr|A0A0A1NDE8|A0A0A1NDE8_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEI90569.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMCBS344292_04891 OC=Rhizopodaceae; Rhizopus.
Sequence
MFLFSKKSSSEITSKIEQTVNEETVDWTSVFEICKLVSQNKTGAKEARKLLQKKMMDNNP
RIQMTSLEIMNALIENDWRTMQTEVTAKSFGEDLCRLASSKLAESLDSWIVRYQGVSKTE
ALVKAQEEIVKQATIPRRGIRQSLEQPEMNIREMIEVAKNSAQVLSQTLSFTDPTKEDIS
KNTLIQEFYAKCKHAQTALKAQLETCQDPDLNTDMLNTFYELDHCFKTYESMLEQQMVYR
AMIDSQTNHRTTQVESSTSSSSMQPSAFNPFSDDYQVQHSLTKNQE
Download sequence
Identical sequences A0A0A1NDE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]