SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1T567 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1T567
Domain Number 1 Region: 1243-1279,1356-1521
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.8e-18
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 925-1282
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000755
Family Ankyrin repeat 0.0069
Further Details:      
 
Domain Number 3 Region: 173-221,262-281,319-444,524-567
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000862
Family Ankyrin repeat 0.0088
Further Details:      
 
Domain Number 4 Region: 749-978
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000606
Family Ankyrin repeat 0.0086
Further Details:      
 
Domain Number 5 Region: 428-622
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000085
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1T567
Sequence length 1843
Comment (tr|A0A0A1T567|A0A0A1T567_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:CEJ89964.1} KW=Complete proteome; Reference proteome OX=1531966 OS=Torrubiella hemipterigena. GN=VHEMI05778 OC=Torrubiella.
Sequence
MSLMTSHDRQLRILQLAQEWDIALPPLLGPLTRPENPPSFQTPDDDNSADMLIQYRVLDM
AQAKPKSPLSRAFSSSGLKRGKHWEPRDIVDTLAGVIATGGSAGVAEALLNKLAASGVEL
QVAAKQKSGLLNRKKSVDSFVDRTALLRMAVDGNQLEMTELLLPLADPVALDTCLPLAIR
LGNPRLVEQLLRYGASVGEHGEGTDVFRQACVHDALAPIVGLILRSDGRPPTQLVSEAMV
DAARAGSVENVVQLSKATADGDYNQAEALRCAVAIGRRDIVLAIVMGLRPPQPSSINDAF
LMLAEHPTLDKSSKLEISEILLCAGANGSIVAHVLEQSCSNDFIDMARLLATHGASIEYN
NGAALKQAISSNRMDYVMAIFNESSSLNSTLASECTSLVPKQVTFEVRNELLTLLLKKGA
SGRPLDQCLIDAAETGDLTAVDLLLQPYFALPPGQQAINRQSLRHQVASPNYRSGEALRT
AVLRADILLAEKILAARPTSDTLTAVFPLTRNLYQSDRSQMIELFLRGSLSGECLHVALQ
DSLDSPASQRDDDLIKLLLDHGADINYNSGEALVPIIKQMDLKFLNGIIAKVSPQTAAIH
IQHAVKVPDHKARFEILTMLLRMGAAIGIKEINGAIIDTILEKPVDLAILQLLLDKGNAD
INNMDGAIVKKAMENNDPQVLETVLTYGKPNEITISRALQDLAGMFSNETKKRKISALLA
KSSRIDDLNRILLHEAQSLIQHRDKSPSMATFEHLLEAGADPNSYKAATLCHAVIGTNDA
ILDLIFKCRYPPTVVSLGFALPHALRVTNADARLNLTTRLVESGADALEVNRALTYGIGA
YPKSTMLLAILAKSADMSDGEALPMAVTKQLPELVDVILHSFKHTQDVRHVAMGQAIEIK
NRSIRTIICELLLEVGVSTDIASGALLVAARDGDLALGKLLMAHGASISGNSGQAIIEGS
RGGSVEVLDVLLKSGAEPTKLTLEKAFQAATEVRDLSKRAVIFELLLSKGVSGQIVDSQL
ESAARYGESGQALLKVLLASGADPNYSDGEAVLAATRSANVICLELLLGIWSDNLNQIPV
SNPVLSSALNASLQLNRSIRFRIVQSLITAGLPADETVHKVLNHVVKEEDPEERLVKLLI
DHGASPTANDCQSLIDASNNVAAKCLPLLFTREMPKVDINRAYSSSFTAERYKKWFTDDG
LRTAKLLLDKGAKGTKGEALSSSLVLVLKNSTEATNNLSDRFVSLLVSYGPDVNFNHGEP
LQVAASKANVGWAKALLTCKPNSETLSLAFQCIFDTALSEEDVLQLFKLFADYRQDGSEI
DVMTKQQGEQPILVRAMSQYPRSTTVVSTLLDAGYYHDQRVKCKLHEDADEEEVVTLLVW
AIAQPQKKVSTAVIETLTERGANVNTPSSITSTTPLMLAIQCRRPDVVNTLLLEGADVDV
VDQQGRTPLAMTTLMGGDVAVKMMSSILAADPSSDDGSLHNSAQQLNMAAVKVLIKAGHH
PDFPSAIHNGRSALSEVCLHGTNNDLAPAELERQMQKIMSFLLESNSDPAIKYNGKSALL
LCFDATNPIVATRALLKSGFWKHIDKSFNYYTDESHTYSPTMYLKKLVKPSDTIEDLIGI
LRANRATDVFYANNGAQPEDAAGLPEDIAVLERARLARLARLAEESQEHATLLARRREAA
SVEQQISDQRAQLEETRRRRQQSEELQAMKTKANLEEDIAAATMQRRMAEQHMLTEAHMN
RSRALATAEQQAQEIKQRKALEWEGLMNKERIDNTRQMSAIRISEREAVDRIDSVAEQRL
GKRLDSQRKLVESQERLAGRIAAGTGTSNADARRQIGFVTELN
Download sequence
Identical sequences A0A0A1T567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]