SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1THJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1THJ0
Domain Number 1 Region: 356-468,508-530
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000824
Family Regulator of G-protein signaling, RGS 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1THJ0
Sequence length 543
Comment (tr|A0A0A1THJ0|A0A0A1THJ0_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:CEJ89985.1} KW=Complete proteome; Reference proteome OX=1531966 OS=Torrubiella hemipterigena. GN=VHEMI05799 OC=Torrubiella.
Sequence
MGSELGKTVDTKPQVRLNGLGIFWLTFGIAWTLILLGGIAFLWIRRNMPILRIRGLPLSI
GAVLLMHVYWFCVTTGYVYGPVMPEVTEYWIMGLWLPFGVALFHASNSRFLYVANAQKKF
SKQSTEPYRIYTRRPGRLSLRESIKMWWIQLDYSNKTLIVVSVGMAFQAFMTIFIYLISR
KFHSDYGIPGTEVTGTPMEIAVQQGRGWEWWPTCFWQLGWAWIVAPIILFRSRKIADTQG
WRFQTIACCIAGLPAAPMWLIALYVPAMAPVNNYFIPPSWIAVSIMFLEIFTIFVPIYEV
VKQRNLTSETLESIARWESRQRLGATKGVKSLNSDISGTTWNSRNSRATSIGTSSGGSIL
TMDALEHTLDKNPEPLQEFSALKDFSGENVAFLLRVRDWRAAHFAVAKKEIGEEEKNTPI
IAITRECFEGALHIYLDFISATNAEFQLNLASGDFAKLKHTFEEAAQAVCAATVASDPAT
PFANETPRLASEILNYTGEIPFEFNEHVFDDAELSIKYLVLTNTWPKYIRQRRSFDASSV
DTV
Download sequence
Identical sequences A0A0A1THJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]