SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1TNM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1TNM5
Domain Number 1 Region: 181-202,230-318
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000157
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1TNM5
Sequence length 345
Comment (tr|A0A0A1TNM5|A0A0A1TNM5_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:CEJ92142.1} KW=Complete proteome; Reference proteome OX=1531966 OS=Torrubiella hemipterigena. GN=VHEMI07811 OC=Torrubiella.
Sequence
MQMSTEDAVKALTSTPSTITRALELVAGNNQQMLLLQQEILRNISILDESRMFLQQFLSK
INEPVAEITSDVLHAVAAYFDPDTLRAFIAKSSQQSLQILDLLSSAKSNWKWKDVMLEVI
FELAPAAEFWEQIQFRLTHSTSIEEMSTLLRKTRQVPTKELVTSVNGILLQLRRTTPLSS
EDKLAVLKHLLERCSNMDDMDGVNFQLAVAYCPLSAIDLLLEYLPRNCVTGEIILSAAAR
NRTDGPDIMERLLEMQEPYAAVASRVIISAVQNNINALKFLLELYGDEMKITADILMYAR
GYSVFDLLLFYTRDDVMAAAPMALHLASRYDRKHLKLRKMKSLLS
Download sequence
Identical sequences A0A0A1TNM5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]