SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1TUN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1TUN7
Domain Number 1 Region: 403-441,587-745,892-1020,1525-1564
Classification Level Classification E-value
Superfamily ARM repeat 0.00000209
Family Clathrin adaptor core protein 0.054
Further Details:      
 
Weak hits

Sequence:  A0A0A1TUN7
Domain Number - Region: 1389-1615
Classification Level Classification E-value
Superfamily ARM repeat 0.000691
Family GUN4-associated domain 0.073
Further Details:      
 
Domain Number - Region: 827-893
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0388
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1TUN7
Sequence length 1673
Comment (tr|A0A0A1TUN7|A0A0A1TUN7_ENTIV) Uncharacterized protein {ECO:0000313|EMBL:ELP83779.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_470230 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEIERVPERPIERLWESYLGKYLPIVPVLQNIVHKTIFALNPALLSKSYTELTHTLSYLQ
EFMYSGIGLTDDELKEFLTFAYNSISDSYYNKKHQKAISSITELILSSAHVKGMFGVPDS
YITSFSTITDADQIYGLIYLRDHSEDPLKGLELDYKPSFKKINKGADLPFLSGLLLIHFK
NFFKLSDAKEIIERIRIFPNSNNGLKKTYLINAFMPSLSYDNFLNDMVKEWEHGYTSDAK
DYFNMMCLSDILVNTELLPDDDFINFLFDRINHDIFYEFNGGDGVLDGINNPFKGLVVFK
PDEEEFIGVSSLLIIALLKNEILQLNGEHTEHTDAKMEEENLKVPKTLLRIRTFFESVHR
AVSDDNDGVVSVISFIKSLVVYFVHEKLHEKMRTTCVRHFVYSIFKTLKPMFFMDNVTMI
CKDILKRLRRVLSSKPDEHHFQTYLIVVSLFIEIFDELVDENDETALEIIKIVFELHRNY
PNVSEINMIVGDMFLVLSRRFYIVDTPPDNVSEDSVQKGVFYLLPEIIVEYFGSMLEMMK
NGSNMEAISLGNEYYNSIETLLHIEGDHRKVIEGKILKHISESTVLVECLSVIVEIFVYY
SEKFANELIEITLNKICERKNETIVINELSTNEKIYWLTILCTSLAHRTNFTKYGKTVMF
VINHFLDSPKDKVKEKAIECGKKICAIGGMVFSLPLFKPKFPIVFQSHCELTKDTHVDPE
IQSDHKFFQEFYNTFVYDNFEKLKQLAEMQDDTLKGKRNDLLHVLSCLEVFEEAASVLYD
IREHKAQLPEEFECLRFELESVYERKMNWESVGHIMIAISKRVRTLFLDDKKIIEKLLKI
LRTYLRKQSQNYTPSSVSFLIHPTKRTFHTKFPPIIFYEQATSILYQLQSFVYDLLYTQL
DVDLFIEEELLTINICDGDFHQYSNSCNLLRHGQAKEIIEKLMANLPKEITKNNINSYIF
ALKILCTYVNHLEVKDIYLLFDVIKHFIQSELNNFAVFRDVALTTLVSQIELAVETCNIH
QIKELPEDFMQLLYKGCNTNPLMHRILSKVVSMYLMKRGKVVPVSLIYYSLEQLLMPLPL
PKRYGTILRLCIQNFDKKRGLFLVLKSTDRSTYFKEIAKMIRKKTFCITQSELLSQDLKT
DDFSEHHNLHLINEFTSKFGEAGLFSAVEKSIDIPQDIKERLEKFVDDKEKLEKYITLLG
FIVTNDIVGDEDDEEGKYISLNDYLLLHQFIQIFGKKVSNLLLDMTEERLSKKNKDEFRK
AMVLFQIVLEGNEMLEIEEMREVTERLGQIMDGILSQQYEDAYAYANRLHAMFSCRSDPR
ITKPFELIAMGKRSVLSQMYILTASRARFDLLDPALVIFEEIVRNPIEQLIECAITFGSK
CLVYQMQYPEEMKNFMEVFEKLVNEMPEKREDNNNAIALPPQYKIIPKILFPSYEQSFII
KEDTVNLLEKVYVKLLSYATSTHGVMDDVAEIFDNYSPLFMEEKSFGVFLEFLLKTIKEN
ACSQNQVGILARNISVTIYVHEFRMTEEKIRRVLETMFELLVSPLLQVRIIVADTILAVF
DIFHPIELICEFIEKLKKKVEEGGNENYQHAYILAVSALIGTYKTDIPPFFVNILVDFAA
MPFAVNSCISAKKRALLEFWESRKDMWDVYYAPLFTTDQRILLKEGSTPQYIV
Download sequence
Identical sequences A0A0A1TUN7
XP_004183125.1.21224 jCVI|EIN_277990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]