SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1U360 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1U360
Domain Number 1 Region: 47-136
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.2e-29
Family TATA-box binding protein (TBP), C-terminal domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 139-227
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 8.01e-28
Family TATA-box binding protein (TBP), C-terminal domain 0.0000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1U360
Sequence length 233
Comment (tr|A0A0A1U360|A0A0A1U360_ENTIV) TATA-box-binding protein, putative {ECO:0000313|EMBL:ELP87178.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_092850 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSLPDSQFSPFMMGSTTDFRQLSQIGTSIYGDRLSTTTESQDRLNNPNETHPEIVNVVST
FQLNQQLDLRKIVQKARNAEYNPKRFAGAIMRISSPKSTALIFQTGKIVCTGTRSIEESK
IAAKKYAKIIKKIGYNEVRFSNFNVQNIVGSCDVKFQISLRSLYDSNTDMCQYEPEVFPG
LVFRMTQPKVTLLVFSTGKVVLTGAKDDESLNTAYTKIYPILLANKKEEIGNP
Download sequence
Identical sequences A0A0A1U360
jCVI|EIN_057210 XP_004253949.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]