SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1U510 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1U510
Domain Number 1 Region: 13-143
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.54e-29
Family Poly(A) polymerase, PAP, N-terminal domain 0.036
Further Details:      
 
Domain Number 2 Region: 158-273
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.22e-25
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1U510
Sequence length 344
Comment (tr|A0A0A1U510|A0A0A1U510_ENTIV) PAP-associated domain containing protein, putative {ECO:0000313|EMBL:ELP89279.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_487910 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MWLRSVCPTDKLTLTEEIKLFTRYISLTPNEQELRQISYQKVSQLLTNRYPGCEVTIYGS
YVSGFSLPSSDIDLVLSFSEEVSKNQVKKLLFKISTICRSSKFLRVEDVITNAKVPIIKL
LDLDTTISIDLSINCEGGIDSSALTHSLLTSSQFTQEIALFVKYLVFQNNLNEPYHGGIG
SYAIVLLTATFLKFYPQHSLGRALVEFLNFYGNIFKMGKTGVSYQHGFFSLVEKNLFEED
SLVIEDPCDEGNNVGRSSFKFNAVQFLFKKTLMGINLIIKNPEGMYLPSGSRLAKVVAIP
KSLQKYREAIDAVKSEQKSEEKTEEKEEVEVMKSPEIYNEPLVQ
Download sequence
Identical sequences A0A0A1U510
jCVI|EIN_289710 XP_004256050.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]