SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1UF37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1UF37
Domain Number 1 Region: 167-300
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000147
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1UF37
Sequence length 719
Comment (tr|A0A0A1UF37|A0A0A1UF37_ENTIV) Regulator of G protein signaling domain containing protein {ECO:0000313|EMBL:ELP95098.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_254420 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MTKKDTHTLQQLMEPFDTVLSSILSVPVKHSFDAYKRTTINLVTDFKNLVTSLKVVTNNI
KAINSQLHSFYADSPSIIQNEVLQFTKQNDDFGFKSLAFLENEVVCLDAHLKDLTKRFAK
MNNEETMAFNEQRFDWIDSCVVVYMQLLVELLSEKGTNFKHLMVFAVQDGISIPKSLTVL
SSLKTIMDSRVGCHYLSKYLTQFGMEKQVEFYRDVTVFSTTKNTTTLDILGKEIFEKFIQ
EESIDQVVISKETQAQIIERYKEPYPQNLYEAAQEDVLDKLLSLGVFEQFQASVDFKKLI
RRLTPIKVRSEKSPRNLSAQITYCNVVCEVETYSVVAKYLIPYNLVIFTEIFVKKGFTSP
QLMAMATVKDFEEVKLSDVDKKRLDQFFKIVKDGKIQSADIFTKETIVCIKPIQDNFIKY
LSETTECLKNTLDFLKYLKETKQEQMAVAQLWSRAEMAFLELKAKHHVAYRMLKKCNTIE
EMKVTIPQCQSGLVSLLTDQYLDSYNASFYWKTPLRKTPRETPRQRAEREKSSKTPELFS
RRVCSPTRRSITPQNDELAVIPSPRIDDDCNRSSGCSPNIGLGNNLEIFDEKSLVKNHEK
KKEKEEKCCQKDKAKRSSFNHRYKQDEISEATDYRITQTQNSIQRIILPKISLLLQELEK
INTKEDLEMFQHENIKIEKTLKEFETENSSPQKVKSQGQNDNLKEIVLAEINKYKQFYT
Download sequence
Identical sequences A0A0A1UF37
XP_004261869.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]