SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1UKX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1UKX9
Domain Number 1 Region: 114-152,181-223,262-285
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000188
Family Regulator of G-protein signaling, RGS 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1UKX9
Sequence length 593
Comment (tr|A0A0A1UKX9|A0A0A1UKX9_9HOMO) Transmembrane protein, putative {ECO:0000313|EMBL:EUC59510.1} KW=Complete proteome OX=1086054 OS=Rhizoctonia solani AG-3 Rhs1AP. GN=RSOL_315690 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MASNASRPTMTTEITIEPRQSGPDDMDIPLSDFSGHLESGPAGPEWERMELPFNLPIIAP
SISNEQPSTWSLSPTAIKGLPSRLKNAPPRPRGTLLKKRFTVVPEYDIPLSDILNDLHAS
PLSLREFEEYLLYVERTVENLYFCLWLKQYTQTYRDWEQRQPPPASDTPSTSTFRCPDQS
INVPLAHSFQRAKRLFFDPASQYELNVTEDMIDPIRQWVKPPKKRNSKKPRRVEVWEEEE
ESPEPEPEHEIQELPPLVHPHPDLFQRVLTEIEGSLRQSLTRFFQLSFTNSGRSHDKLGY
GIWLIYTIASVATSIALILNHKHRALRLVVAPMLLIGWSVGISTYNGNPYETARIDWKYV
GGDNKDVTSADPIIRPKRSYRPRRPTRFPAVRRVLGTRAHKQHSKPQPDLERGKQTTGFG
FRVQHEPDHDPSFGNLHETLELETPMPKCPTPAYIPGQHNSTLTVHRLGEQMHKHPWTPT
AAAFGGFDIYMLRLQPCSRRRRPHMPHHHHHASNHSNASPESCETEVEIPDQDEFAQGLG
LDLRDPRALGFYGHMVTIPNPLVRHVHREIFVRAFWMAVMVTVPIMVTLLVIP
Download sequence
Identical sequences A0A074S6F0 A0A0A1UKX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]