SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1UQ20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1UQ20
Domain Number 1 Region: 347-459,519-542
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000662
Family Regulator of G-protein signaling, RGS 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1UQ20
Sequence length 570
Comment (tr|A0A0A1UQ20|A0A0A1UQ20_9HYPO) Regulator of G protein signaling {ECO:0000313|EMBL:EXU97746.1} KW=Complete proteome OX=568076 OS=Metarhizium robertsii. GN=X797_009130 OC=Metarhizium.
Sequence
MGSEFGVTADSKKEANLDGVGIWWITWACVWTFVLLCGMGYLIHRRDTPILRIRGIGLSL
AAVVLLHLYFFSVQLGYVVGALAPGDCEYWIMGTYLPLGIAMFHASNSRFLYVAKVQKKY
LNRQVDGPAKSRRGMGILDRFRSLNYTTRMVILVSMGMGFQLFLTILMWLISRKWHSGWG
IPGTEVYGTEMEQRMEMGRGWEWWPGIFWQFVWAWIVAPCVLWQSRNINDTHGWRLQTIG
CAVAGLHATPMWLIALYVPAMEPVNKYFLPPQWICISILVLEILTVFLPCWEVVQASTLR
QETLDSIAQWERKNKNTGSSAKSVNTASTAIDSLMSGRKSTVGSVKSTDSQESILTMSAL
EYVLERNPTPLQEFSSLRDFSGENIAFLTSVAEWKTSLPQPVRDGVKDSTTRELIRERFN
SALRIYAEFISIKDAEFPINISSMELKRMEAVFEASARTLYGDKVEVDPATPFDFPEAAQ
KTSMETSSQASEKGRPAGTSYSDGVKFWGEIPESFDETVFDESEKHIKYLVLTNTWPKFV
KDRRVSIDMGASAERGPSIMSFVRSRRQKR
Download sequence
Identical sequences A0A0A1UQ20 E9F6A1
XP_007823989.1.8330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]