SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1WD14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1WD14
Domain Number 1 Region: 39-145
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 6.88e-33
Family Transforming growth factor (TGF)-beta 0.0000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1WD14
Sequence length 146
Comment (tr|A0A0A1WD14|A0A0A1WD14_ZEUCU) Inhibin beta chain {ECO:0000313|EMBL:JAC96853.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.13348 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MHLKSPVSLELSPNRPFLVLRTETRILRRVRRRAIDCVGAMHGQCCKESFYVSFKALGWD
DWIIAPRGYFANYCRGDCSGPFRTPDTFQTFHAHFIEEYRKMGLLNGMQPCCAPVKFSSM
SLIYYGDDGIIKRDLPKMVVDECGCP
Download sequence
Identical sequences A0A0A1WD14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]