SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1WKY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1WKY0
Domain Number 1 Region: 39-99
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000288
Family Tachycitin 0.012
Further Details:      
 
Domain Number 2 Region: 149-199
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000314
Family Tachycitin 0.0064
Further Details:      
 
Domain Number 3 Region: 242-297
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000016
Family Tachycitin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1WKY0
Sequence length 308
Comment (tr|A0A0A1WKY0|A0A0A1WKY0_ZEUCU) Peritrophin-1 {ECO:0000313|EMBL:JAC99179.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.4893 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MATKPLRVAYICLAWATLIQDTKSDTSHSLIPTNKRRQSNICQNHTAGEFDRNPDDCRSF
YLCLENGQAVMAPCPPTMLFNAVSKLCDTAENVNCDISIPSGSSNSNNNNNGLASNGNSN
GNDGAADADGNNEVLSASRYCASQQSEQNRIVFIGSNSNCQQYFICYYGQAVLQECSANL
HWNAKTGKCDLPEKAGCQLWDGDVGVGEYAPVNGAGSSANTAGMPSQGSESGEQSTVGEL
IDCPIYGQHVFPHMSRCDYFIYCVKGYAILQQCPFYHNFDIVSKRCKWRTAAVCVRDLNI
NFNKLIAK
Download sequence
Identical sequences A0A0A1WKY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]