SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1WSY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1WSY3
Domain Number 1 Region: 85-141,256-355
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-22
Family Regulator of G-protein signaling, RGS 0.0098
Further Details:      
 
Domain Number 2 Region: 359-505
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.21e-22
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1WSY3
Sequence length 706
Comment (tr|A0A0A1WSY3|A0A0A1WSY3_ZEUCU) A-kinase anchor protein 10, mitochondrial {ECO:0000313|EMBL:JAD01615.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.48023 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MLKYFKKRKGLRCRAAGTDDPFGKSCGDLAELGLGYRESDNKRHSLHSSSSFCDDVLSQI
SADVDTIDGDESSCGRSILSNDDIFHYKSRLAMSISSIVSDPNCLTYFVQFLDTMNALPL
LKFYLDTENFKTAALGYSEGEQLSGVQGTLEYKKELQNCKVFKTVDTTRIDLGNEDEINA
TCTQDDDKVPELKSFYDLSMRQPLTDDEKSKIYAETNKQIHQCAEHTRAINLNSENKPCS
DSDSVRNGTKTSIGPASVKDAIAIYQKYLIADAKQFISLPVDILSDISLVLCQRTEIVKE
MSTPNQPEVESMPTIPATCFVEAQRYVLDHLERVYLNEFLQSSFYGKYSVELIENCNPQL
SIYDILYSEATLFFFMEFLEQHNERECLDFWTSAINYRKSYIPAVSDRQNVFAQEKDKSN
FKNTAQLEAQSDAMIIYEKFFSLQSENRFWLSDRLRSQVEEHICADDRVAYCFDLPLQLV
AKYLERKYFLDFLKSQLFQNYVKELKFKIREVDVSATSTDDDKVTSSVPAGGVFGKTLHR
KTLSDCSDESKREVFRHNTLLAMDGNKLPQTRIKSIPQATGTDLHIDARHLINPNLLWRR
SQSIDGVSLKFGHINELGRYERDFEAVDAVGAEAASGGKHNWPLRLSGNKIKNAMRKLVH
LPEERAQEEIAWQVAEMIIKDVTSVTLGQDQINTTTAINNKNAGKY
Download sequence
Identical sequences A0A0A1WSY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]